PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG032598.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 559aa    MW: 61568.3 Da    PI: 4.68
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG032598.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-174087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
      CCG032598.1 40 KGPWTSAEDAILIEYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding53.74.9e-1793136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE++l++++++++G++ W++ a++++ gRt++++k++w++
      CCG032598.1  93 KGAFTQEEEQLIIELHAKMGNK-WALMAAHLP-GRTDNEIKNYWNT 136
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3833587IPR017930Myb domain
SuperFamilySSF466891.5E-3039134IPR009057Homeodomain-like
SMARTSM007171.2E-153989IPR001005SANT/Myb domain
PfamPF002491.5E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-244194IPR009057Homeodomain-like
CDDcd001674.18E-124287No hitNo description
PROSITE profilePS5129426.78588142IPR017930Myb domain
SMARTSM007172.4E-1792140IPR001005SANT/Myb domain
PfamPF002495.0E-1693136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2695141IPR009057Homeodomain-like
CDDcd001671.25E-1295136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MSRMTSESEN GIVSNNQIEL PLGEEGNYCG SANGGVVLKK GPWTSAEDAI LIEYVKKHGE  60
GNWNAVQKHS GLFRCGKSCR LRWANHLRPN LKKGAFTQEE EQLIIELHAK MGNKWALMAA  120
HLPGRTDNEI KNYWNTRIKR RQRAGLPLYP PEASLQALQE SQRCLNIDRI EIRNKSQHDT  180
LQSNSYGIPN VIFDNLTPNQ SIIPYVPELP DITASSMLMK GLSSFQYGSI MSPIMHRQKR  240
LREATTLLSS FGGGMKNEFH LFDQFQEVDI AAQSFGLPFP FDYDSTTKNP EFFGENQGSH  300
TLANGNFSAS KPTSEAVKLE LPSLQYSESD LGGWGPSCSP SPLIESVDAF IQSPPTGTVE  360
SECPSPRNSG LLDALLHEAK TLSSAKNQLS DKSSNSSTVT PGDNADSPGL NISETEWEDY  420
GHPFSPLGHT ATSLFSECTP ISANESSLDE SPSCETFTEC YVKSESVDQT WTADREKESS  480
TWLDITSPDA LLDSGWLEHD SAYGKDQVIV TDAVETLLCD DLSSESKQMA AGASVNHGWG  540
HSSCSWNNMP AVYQMYELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31381415107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011034643.10.0PREDICTED: transcription factor GAMYB-like isoform X3
TrEMBLB9GLT00.0B9GLT0_POPTR; Uncharacterized protein
STRINGPOPTR_0001s07330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-133myb domain protein 33